PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G018500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 703aa    MW: 77639.2 Da    PI: 5.7355
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G018500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.51.1e-5661331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeel+ +yLk+k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd
  Brast02G018500.1.p   6 LPPGFRFHPTDEELIIYYLKRKINGRQIEL-EIIPEVDLYKCEPWDLPeKsFLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKD 95 
                         79****************************.99**************95334455777********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v s ++++vg+kktLv+y+grap+g++tdWvmheyrl
  Brast02G018500.1.p  96 RKVNS-QRRAVGMKKTLVYYRGRAPHGSRTDWVMHEYRL 133
                         *****.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.19E-644156IPR003441NAC domain
PROSITE profilePS5100561.8176156IPR003441NAC domain
PfamPF023651.7E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI IYYLKRKING RQIELEIIPE VDLYKCEPWD LPEKSFLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QRRAVGMKKT LVYYRGRAPH  120
GSRTDWVMHE YRLDESECEI DNGLQDAYAL CRIFKKTAPG PKIIEHYGAV QYHAEQPQWA  180
ASCSVERSPT LDVSCDGRGG GDEFETNSFS FPTEAASMAS GSMHGGCGFG MPMISGGAPQ  240
EDGRWMQFLS EDAFNATNPF FMNPASSSNF SCFPSKVDVA LECARLQYRL DLPPPLEVED  300
FPQDVSLDTK TGILRSNPNE VDILQEFLSV ASASQELING SSSSYTETWL GGAGTSSAGN  360
HYMNELSSLV DLGATKAKEE ADNFYQLCSI GASMTSRDEQ ARLVEISDIE EFKEEKRPVE  420
NLRGVKLVNN DLGEIVVEGD EGNQTEVITH YPIKDAAGTS GEAGHHLTDA TDDDTAPIFS  480
QSQPDDFAII AAAGFHDEEG ENASLDLYDK QVVNVQHGLF VSRVGAAETF FHRVEPPNKV  540
SFHLNPAVSR SVGKAIFEKI HCYYHYHPVT SKVSGSSKVS SIFGKVKALV RDKFMARKPS  600
LSLHRRSEET ATLSELLQIV SLLVAAPSNK EVTEQGELVA RKKAKEPVMM KPPVWGCGHG  660
CDNPWLPKRN NSKGISGMFF SGKWAFLTSA LLAIRAPAGS CN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-55116212171NAC domain-containing protein 19
4dul_A2e-55116212171NAC domain-containing protein 19
1ut7_B2e-55116212171NO APICAL MERISTEM PROTEIN
1ut7_A2e-55116212171NO APICAL MERISTEM PROTEIN
1ut4_B2e-55116212171NO APICAL MERISTEM PROTEIN
1ut4_A2e-55116212171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279781e-169KJ727978.1 Zea mays clone pUT6092 NAC transcription factor (NAC78) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562178.10.0PREDICTED: uncharacterized protein LOC100843938 isoform X2
TrEMBLI1HAF20.0I1HAF2_BRADI; Uncharacterized protein
STRINGBRADI1G77217.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP66243651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-119NAC domain containing protein 28